FBXO18 polyclonal antibody
  • FBXO18 polyclonal antibody

FBXO18 polyclonal antibody

Ref: AB-PAB20133
FBXO18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBXO18.
Información adicional
Size 100 uL
Gene Name FBXO18
Gene Alias FBH1|FLJ14590|Fbx18|MGC131916|MGC141935|MGC141937
Gene Description F-box protein, helicase, 18
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HQMTHDGYLKLWQLSKPSLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDAK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBXO18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84893
Iso type IgG

Enviar un mensaje


FBXO18 polyclonal antibody

FBXO18 polyclonal antibody