NRXN3 polyclonal antibody
  • NRXN3 polyclonal antibody

NRXN3 polyclonal antibody

Ref: AB-PAB20129
NRXN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NRXN3.
Información adicional
Size 100 uL
Gene Name NRXN3
Gene Alias KIAA0743|MGC176711
Gene Description neurexin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVECEPSTANPTEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NRXN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9369
Iso type IgG

Enviar un mensaje


NRXN3 polyclonal antibody

NRXN3 polyclonal antibody