SMEK1 polyclonal antibody
  • SMEK1 polyclonal antibody

SMEK1 polyclonal antibody

Ref: AB-PAB20123
SMEK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SMEK1.
Información adicional
Size 100 uL
Gene Name SMEK1
Gene Alias FLFL1|KIAA2010|MSTP033|PP4R3A|smk-1|smk1
Gene Description SMEK homolog 1, suppressor of mek1 (Dictyostelium)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SMEK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55671
Iso type IgG

Enviar un mensaje


SMEK1 polyclonal antibody

SMEK1 polyclonal antibody