PDGFB polyclonal antibody
  • PDGFB polyclonal antibody

PDGFB polyclonal antibody

Ref: AB-PAB16179
PDGFB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against PDGFB.
Información adicional
Size 100 ug
Gene Name PDGFB
Gene Alias FLJ12858|PDGF2|SIS|SSV|c-sis
Gene Description platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with deionized water, store at 4C for one month. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC,ELISA
Immunogen Prot. Seq IEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTI
Form Lyophilized
Recomended Dilution ELISA (1-2 ug/mL)
Western Blot (2-10 ug/mL)
Immunohistochemistry (2-10 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Human PDGFB.
Storage Buffer Lyophilized from PBS
Gene ID 5155
Iso type IgG

Enviar un mensaje


PDGFB polyclonal antibody

PDGFB polyclonal antibody