Myt1l polyclonal antibody
  • Myt1l polyclonal antibody

Myt1l polyclonal antibody

Ref: AB-PAB15836
Myt1l polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Myt1l.
Información adicional
Size 50 ug
Gene Name Myt1l
Gene Alias 2900046C06Rik|2900093J19Rik|C630034G21Rik|Nztf1|Pmng1|Png-1|mKIAA1106
Gene Description myelin transcription factor 1-like
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0194. This antibody detects mMYT1L protein.
Application Key WB-Re
Immunogen Prot. Seq RATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESNSQMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPHMDPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 154 amino acids of mouse Myt1l.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 17933

Enviar un mensaje


Myt1l polyclonal antibody

Myt1l polyclonal antibody