Sh2b1 polyclonal antibody
  • Sh2b1 polyclonal antibody

Sh2b1 polyclonal antibody

Ref: AB-PAB15782
Sh2b1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Sh2b1.
Información adicional
Size 50 ug
Gene Name Sh2b1
Gene Alias AI425885|C530001K22Rik|Irip|SH2-B|SH2-Bb|Sh2bpsm1|mKIAA1299
Gene Description SH2B adaptor protein 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX2547. This antibody detects mSH2B1 protein. It also recognizes human SH2B1 protein.
Application Key WB
Immunogen Prot. Seq ERWTHRFERLRLSRGGGTLKDGAGMIQREELLSFMGAEEAAPDPAGVGRGGGAAGLTSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSTITDVRTATALEMPDRENTFVVKVEGPSEYILETSDALHVKAWVSDIQECLSPGPCPAISPRPMTLPH
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 171 amino acids of mouse Sh2b1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 20399

Enviar un mensaje


Sh2b1 polyclonal antibody

Sh2b1 polyclonal antibody