Fdps polyclonal antibody
  • Fdps polyclonal antibody

Fdps polyclonal antibody

Ref: AB-PAB15743
Fdps polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Fdps.
Información adicional
Size 50 ug
Gene Name Fdps
Gene Alias 6030492I17Rik|AI256750|Fdpsl1|MGC107162|mKIAA1293
Gene Description farnesyl diphosphate synthetase
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0577. This antibody detects mFDPS protein. It also recognizes human FDPS protein.
Application Key WB,IHC-P,IHC-Fr
Immunogen Prot. Seq FFQVQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRASPQQRQILEENYGQKDPEKVARVKALYEALDLQSAFFKYEEDSYNRLKSLIEQCSAPLPPSIFMELANKIYKRRK
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 116 amino acids of mouse Fdps.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 110196

Enviar un mensaje


Fdps polyclonal antibody

Fdps polyclonal antibody