Otud4 polyclonal antibody
  • Otud4 polyclonal antibody

Otud4 polyclonal antibody

Ref: AB-PAB15735
Otud4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Otud4.
Información adicional
Size 50 ug
Gene Name Otud4
Gene Alias 4930431L18Rik|AI449692|D8Ertd69e|mKIAA1046
Gene Description OTU domain containing 4
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0383. This antibody detects mOTUD4 protein.
Application Key WB
Immunogen Prot. Seq IVLPPDDKGELDLPLENLDLSKECDSVSAVDEFPDARVEGAHSLSAASVSSKHEGRVEQSSQTRKADIDLASGSSAVEGKGHPPTQILNREREPGSAEPEPKRTIQSLKEKPEKVKDPKTAADVVSPGANSVDRLQRPKEESSEDENEVSNILRSGRSKQFYNQTYGSRKYKSDWGSSGRGGYQHVRGEESWKGQPNRSRDEGYQYHRHVRGRPYRGDRRRSGMGDGHRGQHT
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 233 mouse Otud4.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 73945

Enviar un mensaje


Otud4 polyclonal antibody

Otud4 polyclonal antibody