Bahd1 polyclonal antibody
  • Bahd1 polyclonal antibody

Bahd1 polyclonal antibody

Ref: AB-PAB15734
Bahd1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Bahd1.
Información adicional
Size 50 ug
Gene Name Bahd1
Gene Alias AL022997|AW541238|Gm117|KIAA0945|MGC117747|mKIAA0945
Gene Description bromo adjacent homology domain containing 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0582. This antibody detects mBAHD1 protein.
Application Key WB
Immunogen Prot. Seq AIRKSYQAVERHGETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGLPSRKTALVPPSADYSTPPHRTVPEDTDPELVFLCRHVYDFRHGRILKNPQ
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 170 mouse Bahd1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 228536

Enviar un mensaje


Bahd1 polyclonal antibody

Bahd1 polyclonal antibody