Synj1 polyclonal antibody
  • Synj1 polyclonal antibody

Synj1 polyclonal antibody

Ref: AB-PAB15733
Synj1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Synj1.
Información adicional
Size 50 ug
Gene Name Synj1
Gene Alias A930006D20Rik|AA675315|mKIAA0910
Gene Description synaptojanin 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX1074. This antibody detects mSYNJ1 protein.
Application Key WB
Immunogen Prot. Seq SGARSPAPARKEFGGVGAPPSPGVARREIEAPKSPGTARKDNIGRNQPSPQAGLAGPGPAGYGAARPTIPARAGVISAPQSQARVCAGRPTPDSQSKPSETLKGPAVLPEPLKPQAAFPQQPSLPTPAQK
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 130 mouse Synj1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 104015

Enviar un mensaje


Synj1 polyclonal antibody

Synj1 polyclonal antibody