Csde1 polyclonal antibody
  • Csde1 polyclonal antibody

Csde1 polyclonal antibody

Ref: AB-PAB15731
Csde1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Csde1.
Información adicional
Size 50 ug
Gene Name Csde1
Gene Alias AA960392|BC016898|D3Jfr1|MGC19174|mKIAA0885|unr
Gene Description cold shock domain containing E1, RNA binding
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0341. This antibody detects mCSDE1 protein. It also recognizes human CSDE1 protein.
Application Key WB
Immunogen Prot. Seq QNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGVELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPDNSMGFGAERKIRQAGVID
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 138 mouse Csde1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 229663

Enviar un mensaje


Csde1 polyclonal antibody

Csde1 polyclonal antibody