Arhgef17 polyclonal antibody
  • Arhgef17 polyclonal antibody

Arhgef17 polyclonal antibody

Ref: AB-PAB15715
Arhgef17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Arhgef17.
Información adicional
Size 50 ug
Gene Name Arhgef17
Gene Alias 8030463K16|AI428794|AW558066|BC035332|mKIAA0337
Gene Description Rho guanine nucleotide exchange factor (GEF) 17
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0072. This antibody detects mARHGEF17 protein.
Application Key WB
Immunogen Prot. Seq MLAGSDAIIRQHKAACLRITALLVCAELLWVGTSAGVVLTIPTSPSTVSCPRAPLSPAGLCQGHTGHVRFLAAVQLPEGFNLLCSTPPPPPDTGPEKLPSLDHRDSPRRRGPTSARPKMLVISGGDGSEDFRLSSGGGGSSETVGRDDSTNHLLLWRV
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 158 mouse Arhgef17.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 207212

Enviar un mensaje


Arhgef17 polyclonal antibody

Arhgef17 polyclonal antibody