Astn1 polyclonal antibody
  • Astn1 polyclonal antibody

Astn1 polyclonal antibody

Ref: AB-PAB15713
Astn1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant Astn1.
Información adicional
Size 50 ug
Gene Name Astn1
Gene Alias Astn|GC14|mKIAA0289
Gene Description astrotactin 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0437. This antibody detects mASTN1 protein.
Application Key WB
Immunogen Prot. Seq LYHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKISLRRGSLKYLGCRYSEIKPYGLDWSELSRDLRKTCEEQTLSVPYNDYGDSKDI
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 103 mouse Astn1.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 11899

Enviar un mensaje


Astn1 polyclonal antibody

Astn1 polyclonal antibody