Ver mas grande
Xpo5 polyclonal antibody
AB-PAB15694
Producto nuevo
Xpo5 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Xpo5 |
| Gene Alias | 2410004H11Rik|2700038C24Rik|AI648907|AW549301|Exp5|RanBp21|mKIAA1291 |
| Gene Description | exportin 5 |
| Storage Conditions | Store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Specificity | Specific to recombinant protein GX1085. This antibody detects endogenous mXPO5 protein in several cell types. |
| Application Key | WB |
| Immunogen Prot. Seq | AFQIYEALRPRYLEIRAVMEQIPEINKESLDQFDCKLLNPSLQKAADKRRKDHFKRLIAGCIGKPLGEQFRKEVHIKNLPWLFKKPKPMLETEVLDSEEGGLATIFEP |
| Form | Liquid |
| Recomended Dilution | Western Blot (1:1000)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Immunogen | Recombinant GST fusion protein corresponding to 108 mouse Xpo5. |
| Storage Buffer | In PBS (50% glycerol, 0.02% sodium azide) |
| Gene ID | 72322 |
Más información
Rabbit polyclonal antibody raised against partial recombinant Xpo5.