X99384 polyclonal antibody
  • X99384 polyclonal antibody

X99384 polyclonal antibody

Ref: AB-PAB15693
X99384 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant X99384.
Información adicional
Size 100 ug
Gene Name X99384
Gene Alias MGC169319|MMPAL|Pald|mKIAA1274
Gene Description cDNA sequence X99384
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity Specific to recombinant protein GX0152. This antibody detects endogenous mPaladin protein in several cell types.
Application Key WB
Immunogen Prot. Seq QLLPDGHHVKKEVDAALDIVSETMTPMHYHLREIIISTYRQAKATKEAQEAQRLQLRSLQYLERYIYLILFNAYLRLEKTSSWQRPFSTWMREVATKAGIYEILNQLGFPELESIEEQPLSRLRYRWQEQSRDPEPCDVGDFL
Form Liquid
Recomended Dilution Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen Recombinant GST fusion protein corresponding to 143 mouse X99384.
Storage Buffer In PBS (50% glycerol, 0.02% sodium azide)
Gene ID 27355

Enviar un mensaje


X99384 polyclonal antibody

X99384 polyclonal antibody