UCHL1 monoclonal antibody, clone CL3210
  • UCHL1 monoclonal antibody, clone CL3210

UCHL1 monoclonal antibody, clone CL3210

Ref: AB-MAB15796
UCHL1 monoclonal antibody, clone CL3210

Información del producto

Mouse monoclonal antibody raised against partial recombinant human UCHL1.
Información adicional
Size 100 uL
Gene Name UCHL1
Gene Alias PARK5|PGP9.5|Uch-L1
Gene Description ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UCHL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7345
Clone Number CL3210
Iso type IgG1

Enviar un mensaje


UCHL1 monoclonal antibody, clone CL3210

UCHL1 monoclonal antibody, clone CL3210