TPH2 monoclonal antibody, clone CL2990
  • TPH2 monoclonal antibody, clone CL2990

TPH2 monoclonal antibody, clone CL2990

Ref: AB-MAB15785
TPH2 monoclonal antibody, clone CL2990

Información del producto

Mouse monoclonal antibody raised against partial recombinant human TPH2.
Información adicional
Size 100 uL
Gene Name TPH2
Gene Alias FLJ37295|MGC138871|MGC138872|NTPH
Gene Description tryptophan hydroxylase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TPH2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 121278
Clone Number CL2990
Iso type IgG1

Enviar un mensaje


TPH2 monoclonal antibody, clone CL2990

TPH2 monoclonal antibody, clone CL2990