ACAA1 monoclonal antibody, clone CL2650
  • ACAA1 monoclonal antibody, clone CL2650

ACAA1 monoclonal antibody, clone CL2650

Ref: AB-MAB15764
ACAA1 monoclonal antibody, clone CL2650

Información del producto

Mouse monoclonal antibody raised against partial recombinant human ACAA1.
Información adicional
Size 100 uL
Gene Name ACAA1
Gene Alias ACAA|PTHIO|THIO
Gene Description acetyl-Coenzyme A acyltransferase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ACAA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 30
Clone Number CL2650
Iso type IgG1

Enviar un mensaje


ACAA1 monoclonal antibody, clone CL2650

ACAA1 monoclonal antibody, clone CL2650