Villin monoclonal antibody, clone VIL1/1314
  • Villin monoclonal antibody, clone VIL1/1314

Villin monoclonal antibody, clone VIL1/1314

Ref: AB-MAB15029
Villin monoclonal antibody, clone VIL1/1314

Información del producto

Mouse monoclonal antibody raised against partial recombinant human Villin.
Información adicional
Size 100 ug
Storage Conditions Store at -20 to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF,Flow Cyt
Immunogen Prot. Seq MGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGA
Form Liquid
Recomended Dilution Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL)
Immunofluorescence (1-2 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.25-0.5 ug/mL)
Western Blotting (1-2 ug/mL)
The optimal working dilution should be d
Antigen species Target species Human
Immunogen Recombinant protein corresponding to 133 residues of human Villin.
Storage Buffer In 10 mM PBS.
Clone Number VIL1/1314
Iso type IgG1, kappa

Enviar un mensaje


Villin monoclonal antibody, clone VIL1/1314

Villin monoclonal antibody, clone VIL1/1314