Apoa2 monoclonal antibody (M02), clone 3G3
  • Apoa2 monoclonal antibody (M02), clone 3G3

Apoa2 monoclonal antibody (M02), clone 3G3

Ref: AB-MAB10001-M02
Apoa2 monoclonal antibody (M02), clone 3G3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant Apoa2.
Información adicional
Size 100 ug
Gene Name Apoa2
Gene Alias Alp-2|ApoA-II|ApoAII|Apoa-2|Hdl-1
Gene Description apolipoprotein A-II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK
Antigen species Target species Mouse
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen Apoa2 (NP_038502, 24 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11807
Clone Number 3G3
Iso type IgG1 Kappa

Enviar un mensaje


Apoa2 monoclonal antibody (M02), clone 3G3

Apoa2 monoclonal antibody (M02), clone 3G3