TRIM72 monoclonal antibody (M04), clone 2B8
  • TRIM72 monoclonal antibody (M04), clone 2B8

TRIM72 monoclonal antibody (M04), clone 2B8

Ref: AB-H00493829-M04
TRIM72 monoclonal antibody (M04), clone 2B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LOC493829.
Información adicional
Size 100 ug
Gene Name TRIM72
Gene Alias -
Gene Description tripartite motif-containing 72
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IP,S-ELISA,ELISA
Immunogen Prot. Seq QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM72 (NP_001008275.1, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 493829
Clone Number 2B8
Iso type IgG1 Kappa

Enviar un mensaje


TRIM72 monoclonal antibody (M04), clone 2B8

TRIM72 monoclonal antibody (M04), clone 2B8