TRIM72 monoclonal antibody (M01), clone 2G1
  • TRIM72 monoclonal antibody (M01), clone 2G1

TRIM72 monoclonal antibody (M01), clone 2G1

Ref: AB-H00493829-M01
TRIM72 monoclonal antibody (M01), clone 2G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM72.
Información adicional
Size 100 ug
Gene Name TRIM72
Gene Alias -
Gene Description tripartite motif-containing 72
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,S-ELISA,ELISA
Immunogen Prot. Seq QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM72 (NP_001008275.1, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 493829
Clone Number 2G1
Iso type IgG2a Kappa

Enviar un mensaje


TRIM72 monoclonal antibody (M01), clone 2G1

TRIM72 monoclonal antibody (M01), clone 2G1