TRIM72 purified MaxPab rabbit polyclonal antibody (D01P)
  • TRIM72 purified MaxPab rabbit polyclonal antibody (D01P)

TRIM72 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00493829-D01P
TRIM72 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TRIM72 protein.
Información adicional
Size 100 ug
Gene Name TRIM72
Gene Alias -
Gene Description tripartite motif-containing 72
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPTRPQALSTNLQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGEAGVALRRELGSLNSYLEQLRQMEKVLEEVADKPQTEFLMKYCLVTSRLQKILAES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM72 (AAH33211.1, 1 a.a. ~ 269 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 493829

Enviar un mensaje


TRIM72 purified MaxPab rabbit polyclonal antibody (D01P)

TRIM72 purified MaxPab rabbit polyclonal antibody (D01P)