TRIM6-TRIM34 polyclonal antibody (A01)
  • TRIM6-TRIM34 polyclonal antibody (A01)

TRIM6-TRIM34 polyclonal antibody (A01)

Ref: AB-H00445372-A01
TRIM6-TRIM34 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRIM6-TRIM34.
Información adicional
Size 50 uL
Gene Name TRIM6-TRIM34
Gene Alias IFP1|RNF21|TRIM34
Gene Description TRIM6-TRIM34 readthrough transcript
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LQMFRELTAVRCYWVDVTLNSVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTAWILGVYCRTYSRHMKYVVRRCANRQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM6-TRIM34 (NP_001003819, 641 a.a. ~ 740 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 445372

Enviar un mensaje


TRIM6-TRIM34 polyclonal antibody (A01)

TRIM6-TRIM34 polyclonal antibody (A01)