C9orf152 purified MaxPab mouse polyclonal antibody (B01P)
  • C9orf152 purified MaxPab mouse polyclonal antibody (B01P)

C9orf152 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00401546-B01P
C9orf152 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C9orf152 protein.
Información adicional
Size 50 ug
Gene Name C9orf152
Gene Alias MGC131682|bA470J20.2
Gene Description chromosome 9 open reading frame 152
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C9orf152 (NP_001013011.1, 1 a.a. ~ 218 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 401546

Enviar un mensaje


C9orf152 purified MaxPab mouse polyclonal antibody (B01P)

C9orf152 purified MaxPab mouse polyclonal antibody (B01P)