C5orf48 monoclonal antibody (M01), clone 3G2
  • C5orf48 monoclonal antibody (M01), clone 3G2

C5orf48 monoclonal antibody (M01), clone 3G2

Ref: AB-H00389320-M01
C5orf48 monoclonal antibody (M01), clone 3G2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant C5orf48.
Información adicional
Size 100 ug
Gene Name C5orf48
Gene Alias FLJ27505|MGC163367|MGC163369
Gene Description chromosome 5 open reading frame 48
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MASGKDTCPTLPKLTNNCSDESLYKSANKYEEIHLPRFSLKQGMIPRRYVMPWKENMIFRNVNLKQAEVCGIHTGPLEDSLFLNHSERLCHGEDRKVVFQKGPPEIKIADMPLHSPLSRYQSTVISHGFRRRLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C5orf48 (NP_997291.1, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 389320
Clone Number 3G2
Iso type IgG1 Kappa

Enviar un mensaje


C5orf48 monoclonal antibody (M01), clone 3G2

C5orf48 monoclonal antibody (M01), clone 3G2