C1orf31 monoclonal antibody (M03), clone 4A6
  • C1orf31 monoclonal antibody (M03), clone 4A6

C1orf31 monoclonal antibody (M03), clone 4A6

Ref: AB-H00388753-M03
C1orf31 monoclonal antibody (M03), clone 4A6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant C1orf31.
Información adicional
Size 100 ug
Gene Name C1orf31
Gene Alias -
Gene Description chromosome 1 open reading frame 31
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C1orf31 (NP_001013003.1, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 388753
Clone Number 4A6
Iso type IgG1 Kappa

Enviar un mensaje


C1orf31 monoclonal antibody (M03), clone 4A6

C1orf31 monoclonal antibody (M03), clone 4A6