C9orf169 monoclonal antibody (M09), clone 4E4
  • C9orf169 monoclonal antibody (M09), clone 4E4

C9orf169 monoclonal antibody (M09), clone 4E4

Ref: AB-H00375791-M09
C9orf169 monoclonal antibody (M09), clone 4E4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant C9orf169.
Información adicional
Size 100 ug
Gene Name C9orf169
Gene Alias MGC59937
Gene Description chromosome 9 open reading frame 169
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C9orf169 (NP_945352.1, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 375791
Clone Number 4E4
Iso type IgG2a Kappa

Enviar un mensaje


C9orf169 monoclonal antibody (M09), clone 4E4

C9orf169 monoclonal antibody (M09), clone 4E4