AKR1CL1 purified MaxPab mouse polyclonal antibody (B01P)
  • AKR1CL1 purified MaxPab mouse polyclonal antibody (B01P)

AKR1CL1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00340811-B01P
AKR1CL1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AKR1CL1 protein.
Información adicional
Size 50 ug
Gene Name AKR1CL1
Gene Alias FLJ16347
Gene Description aldo-keto reductase family 1, member C-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MMTDLKQSHSVRLNDGPFMPVLGFGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKREEIFYTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIHVPFAMKGSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AKR1CL1 (NP_001007537.1, 1 a.a. ~ 129 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 340811

Enviar un mensaje


AKR1CL1 purified MaxPab mouse polyclonal antibody (B01P)

AKR1CL1 purified MaxPab mouse polyclonal antibody (B01P)