ZNF707 MaxPab mouse polyclonal antibody (B01)
  • ZNF707 MaxPab mouse polyclonal antibody (B01)

ZNF707 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00286075-B01
ZNF707 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF707 protein.
Información adicional
Size 50 uL
Gene Name ZNF707
Gene Alias -
Gene Description zinc finger protein 707
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQEPVTFRDVAIYFSREEWACLEPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRHCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQLPRAAPERTDAKPTAFPCQVLTQRCGRRPGRRERRKQRAVELSFICGTCGKALSCHSRLLAHQTVHTGTKAFECPECGQTFRWASNLQRHQKNHTREKPFCCEACGQAFSLKDRLAQHRKVHTEH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF707 (NP_776192, 1 a.a. ~ 369 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 286075

Enviar un mensaje


ZNF707 MaxPab mouse polyclonal antibody (B01)

ZNF707 MaxPab mouse polyclonal antibody (B01)