ARL10 purified MaxPab mouse polyclonal antibody (B01P)
  • ARL10 purified MaxPab mouse polyclonal antibody (B01P)

ARL10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00285598-B01P
ARL10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARL10 protein.
Información adicional
Size 50 ug
Gene Name ARL10
Gene Alias ARL10A|FLJ39249
Gene Description ADP-ribosylation factor-like 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEPALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQVRAVRGQLGPGDIHSEMLEQGQGALPGPMAWRGWLRCCPHLFYLCPVLIPASVFLPLCLPIISYSGEM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARL10 (AAH59361.1, 1 a.a. ~ 276 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 285598

Enviar un mensaje


ARL10 purified MaxPab mouse polyclonal antibody (B01P)

ARL10 purified MaxPab mouse polyclonal antibody (B01P)