BTBD8 purified MaxPab mouse polyclonal antibody (B01P)
  • BTBD8 purified MaxPab mouse polyclonal antibody (B01P)

BTBD8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00284697-B01P
BTBD8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BTBD8 protein.
Información adicional
Size 50 ug
Gene Name BTBD8
Gene Alias -
Gene Description BTB (POZ) domain containing 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFKAHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPGCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BTBD8 (NP_899065, 1 a.a. ~ 378 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 284697

Enviar un mensaje


BTBD8 purified MaxPab mouse polyclonal antibody (B01P)

BTBD8 purified MaxPab mouse polyclonal antibody (B01P)