Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
VSTM1 monoclonal antibody (M03), clone 2E12
Abnova
VSTM1 monoclonal antibody (M03), clone 2E12
Ref: AB-H00284415-M03
VSTM1 monoclonal antibody (M03), clone 2E12
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant VSTM1.
Información adicional
Size
100 ug
Gene Name
VSTM1
Gene Alias
MGC119160|MGC119161|UNQ3033
Gene Description
V-set and transmembrane domain containing 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHSELRERKGREGE
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
VSTM1 (AAI00943.1, 1 a.a. ~ 174 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
284415
Clone Number
2E12
Iso type
IgG1 Kappa
Enviar un mensaje
VSTM1 monoclonal antibody (M03), clone 2E12
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*