TSEN54 polyclonal antibody (A01)
  • TSEN54 polyclonal antibody (A01)

TSEN54 polyclonal antibody (A01)

Ref: AB-H00283989-A01
TSEN54 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TSEN54.
Información adicional
Size 50 uL
Gene Name TSEN54
Gene Alias FLJ37147|PCH2A|SEN54L|sen54
Gene Description tRNA splicing endonuclease 54 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LQTTHLPDGGVRLLEKSGGLEIIFDVYQADAVATFRKNNPGKPYARMCISGFDEPVPDLCSLKRLSYQSGDVPLIFALVDHGDISFYSFRDFTLPQDVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSEN54 (NP_997229, 427 a.a. ~ 525 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 283989

Enviar un mensaje


TSEN54 polyclonal antibody (A01)

TSEN54 polyclonal antibody (A01)