C12orf51 polyclonal antibody (A01)
  • C12orf51 polyclonal antibody (A01)

C12orf51 polyclonal antibody (A01)

Ref: AB-H00283450-A01
C12orf51 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C12orf51.
Información adicional
Size 50 uL
Gene Name C12orf51
Gene Alias DKFZp586O1022|FLJ10510|FLJ30092|FLJ30208|FLJ34154|KIAA0614|MGC126531
Gene Description chromosome 12 open reading frame 51
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DQHIEFFWGALEMFTQEELCKFIKFACNQERIPFTCPCKDGGPDTAHVPPYPMKIAPPDGTAGSPDSRYIRVETCMFMIKLPQYSSLEIMLEKLRCAIHYREDPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C12orf51 (XP_497354, 3105 a.a. ~ 3209 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 283450

Enviar un mensaje


C12orf51 polyclonal antibody (A01)

C12orf51 polyclonal antibody (A01)