ALS2CL purified MaxPab mouse polyclonal antibody (B01P)
  • ALS2CL purified MaxPab mouse polyclonal antibody (B01P)

ALS2CL purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00259173-B01P
ALS2CL purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ALS2CL protein.
Información adicional
Size 50 ug
Gene Name ALS2CL
Gene Alias DKFZp686P238|MGC129698|RN49018
Gene Description ALS2 C-terminal like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MCNPEEAALLRLEEVFSATLAHVNSLVLQPLLPAAPDPSDPWGRECLRLLQQLHKSSQQLWEVTEESLHSLQERLRYPDSTGLESLLLLRGADRVLQAHIEYIESYTSCMVVQAFQKAAKRRSEYWRGQRKALRQLLSGVSSEGSVGASLGQALHQPLAHHVQQYVLLLLSLGDTIGEHHPTRELVVNAVTLFGNLQSFMKQELDQAVATQALWHTLRGRLRDVLCTPAHRLLQDSQDVPVTVAPLRAERVLLFD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALS2CL (NP_667340.2, 1 a.a. ~ 953 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 259173

Enviar un mensaje


ALS2CL purified MaxPab mouse polyclonal antibody (B01P)

ALS2CL purified MaxPab mouse polyclonal antibody (B01P)