UTS2D purified MaxPab mouse polyclonal antibody (B01P)
  • UTS2D purified MaxPab mouse polyclonal antibody (B01P)

UTS2D purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00257313-B01P
UTS2D purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UTS2D protein.
Información adicional
Size 50 ug
Gene Name UTS2D
Gene Alias MGC138371|U2B|URP
Gene Description urotensin 2 domain containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNKILSSTVCFGLLTLLSVLIFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UTS2D (NP_937795.1, 1 a.a. ~ 119 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 257313

Enviar un mensaje


UTS2D purified MaxPab mouse polyclonal antibody (B01P)

UTS2D purified MaxPab mouse polyclonal antibody (B01P)