ZNF718 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF718 purified MaxPab mouse polyclonal antibody (B01P)

ZNF718 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00255403-B01P
ZNF718 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF718 protein.
Información adicional
Size 50 ug
Gene Name ZNF718
Gene Alias FLJ90036
Gene Description zinc finger protein 718
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MELLTFKDVAIEFSPEEWKCLDISQQNLYRDVMLENYRNLVSLGVTISNPDLVTSLEQRKEPYNLKIHETAARPPAVCSHFTQNLWTVQGIEDSFHKLIPKGHEKRGHENLRKTCKSINECKVQKGGYNRINQCLLTTQKKTIQSNICVKVFHKFSNSNKDKIRYTGDKTFKCKECGKSFHVLSRLTQHKRIHTGENPYTCEECGKAFNWSSILTKHKRIHAREKFYKCEECGKGFTRSSHLTKHKRIHTGEKPY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF718 (NP_001034216.1, 1 a.a. ~ 478 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 255403

Enviar un mensaje


ZNF718 purified MaxPab mouse polyclonal antibody (B01P)

ZNF718 purified MaxPab mouse polyclonal antibody (B01P)