TMEM86B MaxPab rabbit polyclonal antibody (D01)
  • TMEM86B MaxPab rabbit polyclonal antibody (D01)

TMEM86B MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00255043-D01
TMEM86B MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TMEM86B protein.
Información adicional
Size 100 uL
Gene Name TMEM86B
Gene Alias MGC30208
Gene Description transmembrane protein 86B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCLAGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAAFVPGMAAFATAHLLYVWAFGFSPLQPGLLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGGSAGWGALLFTLSDGVLAWDTFAQPLPHARLVIMTTYYAAQLLITLSALRSPVPKTD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMEM86B (NP_776165.2, 1 a.a. ~ 226 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 255043

Enviar un mensaje


TMEM86B MaxPab rabbit polyclonal antibody (D01)

TMEM86B MaxPab rabbit polyclonal antibody (D01)