ZNF396 MaxPab mouse polyclonal antibody (B01P)
  • ZNF396 MaxPab mouse polyclonal antibody (B01P)

ZNF396 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00252884-B01P
ZNF396 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF396 protein.
Información adicional
Size 50 ug
Gene Name ZNF396
Gene Alias FLJ31213|ZSCAN14
Gene Description zinc finger protein 396
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSAKLGKSSSLLTQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGYQDSPGPHEALSRLWELCHLWLRPEVHTKEQILELLVLEQFLAILPKELQAWVQKHHPENGEETVTMLEDVERELDGPKQIFFGRRKDMIAEKLAPSEITEELPSSQLMPVKKQLQGASWELQSLRPHDEDIKTTNVKSASRQKTSLGIELHCNVSNILHMNGSQSSTYRGTYEQDGRFEKRQGNPSWKKQQKCDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF396 (NP_665699.1, 1 a.a. ~ 333 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 252884

Enviar un mensaje


ZNF396 MaxPab mouse polyclonal antibody (B01P)

ZNF396 MaxPab mouse polyclonal antibody (B01P)