ATP6V0D2 polyclonal antibody (A01)
  • ATP6V0D2 polyclonal antibody (A01)

ATP6V0D2 polyclonal antibody (A01)

Ref: AB-H00245972-A01
ATP6V0D2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ATP6V0D2.
Información adicional
Size 50 uL
Gene Name ATP6V0D2
Gene Alias ATP6D2|FLJ38708|VMA6
Gene Description ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 245972

Enviar un mensaje


ATP6V0D2 polyclonal antibody (A01)

ATP6V0D2 polyclonal antibody (A01)