ATOH7 purified MaxPab rabbit polyclonal antibody (D01P)
  • ATOH7 purified MaxPab rabbit polyclonal antibody (D01P)

ATOH7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00220202-D01P
ATOH7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ATOH7 protein.
Información adicional
Size 100 ug
Gene Name ATOH7
Gene Alias Math5|bHLHa13
Gene Description atonal homolog 7 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ATOH7 (NP_660161.1, 1 a.a. ~ 152 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 220202

Enviar un mensaje


ATOH7 purified MaxPab rabbit polyclonal antibody (D01P)

ATOH7 purified MaxPab rabbit polyclonal antibody (D01P)