UNC5B polyclonal antibody (A01)
  • UNC5B polyclonal antibody (A01)

UNC5B polyclonal antibody (A01)

Ref: AB-H00219699-A01
UNC5B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UNC5B.
Información adicional
Size 50 uL
Gene Name UNC5B
Gene Alias UNC5H2|p53RDL1
Gene Description unc-5 homolog B (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UNC5B (NP_734465, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 219699

Enviar un mensaje


UNC5B polyclonal antibody (A01)

UNC5B polyclonal antibody (A01)