Ver mas grande
UNC5B polyclonal antibody (A01)
AB-H00219699-A01
Producto nuevo
UNC5B polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | UNC5B |
| Gene Alias | UNC5H2|p53RDL1 |
| Gene Description | unc-5 homolog B (C. elegans) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDY |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | UNC5B (NP_734465, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 219699 |
Más información
Mouse polyclonal antibody raised against a partial recombinant UNC5B.