USP12 purified MaxPab mouse polyclonal antibody (B01P)
  • USP12 purified MaxPab mouse polyclonal antibody (B01P)

USP12 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00219333-B01P
USP12 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human USP12 protein.
Información adicional
Size 50 ug
Gene Name USP12
Gene Alias USP12L1
Gene Description ubiquitin specific peptidase 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVDEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP12 (NP_872294.1, 1 a.a. ~ 370 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 219333

Enviar un mensaje


USP12 purified MaxPab mouse polyclonal antibody (B01P)

USP12 purified MaxPab mouse polyclonal antibody (B01P)