USP12 polyclonal antibody (A01)
  • USP12 polyclonal antibody (A01)

USP12 polyclonal antibody (A01)

Ref: AB-H00219333-A01
USP12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP12.
Información adicional
Size 50 uL
Gene Name USP12
Gene Alias USP12L1
Gene Description ubiquitin specific peptidase 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP12 (NP_872294, 69 a.a. ~ 168 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 219333

Enviar un mensaje


USP12 polyclonal antibody (A01)

USP12 polyclonal antibody (A01)