TRIM65 polyclonal antibody (A01)
  • TRIM65 polyclonal antibody (A01)

TRIM65 polyclonal antibody (A01)

Ref: AB-H00201292-A01
TRIM65 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRIM65.
Información adicional
Size 50 uL
Gene Name TRIM65
Gene Alias 4732463G12Rik
Gene Description tripartite motif-containing 65
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GPCSWGLCVQEDSLQAWHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFWLLEGRTLTLCHQPGAVFPLGPQEEVLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM65 (NP_775818, 419 a.a. ~ 517 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 201292

Enviar un mensaje


TRIM65 polyclonal antibody (A01)

TRIM65 polyclonal antibody (A01)