CRTC2 monoclonal antibody (M01), clone 1E6
  • CRTC2 monoclonal antibody (M01), clone 1E6

CRTC2 monoclonal antibody (M01), clone 1E6

Ref: AB-H00200186-M01
CRTC2 monoclonal antibody (M01), clone 1E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRTC2.
Información adicional
Size 100 ug
Gene Name CRTC2
Gene Alias RP11-422P24.6|TORC2
Gene Description CREB regulated transcription coactivator 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRTC2 (NP_859066, 595 a.a. ~ 693 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 200186
Clone Number 1E6
Iso type IgG1 Kappa

Enviar un mensaje


CRTC2 monoclonal antibody (M01), clone 1E6

CRTC2 monoclonal antibody (M01), clone 1E6