AMN1 purified MaxPab mouse polyclonal antibody (B01P)
  • AMN1 purified MaxPab mouse polyclonal antibody (B01P)

AMN1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00196394-B01P
AMN1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AMN1 protein.
Información adicional
Size 50 ug
Gene Name AMN1
Gene Alias -
Gene Description antagonist of mitotic exit network 1 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AMN1 (NP_997220.1, 1 a.a. ~ 213 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 196394

Enviar un mensaje


AMN1 purified MaxPab mouse polyclonal antibody (B01P)

AMN1 purified MaxPab mouse polyclonal antibody (B01P)