ASXL1 monoclonal antibody (M05), clone 6E2
  • ASXL1 monoclonal antibody (M05), clone 6E2

ASXL1 monoclonal antibody (M05), clone 6E2

Ref: AB-H00171023-M05
ASXL1 monoclonal antibody (M05), clone 6E2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ASXL1.
Información adicional
Size 100 ug
Gene Name ASXL1
Gene Alias KIAA0978|MGC117280|MGC71111
Gene Description additional sex combs like 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ASXL1 (AAH64984.1, 1 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 171023
Clone Number 6E2
Iso type IgG2a Kappa

Enviar un mensaje


ASXL1 monoclonal antibody (M05), clone 6E2

ASXL1 monoclonal antibody (M05), clone 6E2