CALML6 purified MaxPab rabbit polyclonal antibody (D01P)
  • CALML6 purified MaxPab rabbit polyclonal antibody (D01P)

CALML6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00163688-D01P
CALML6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CALML6 protein.
Información adicional
Size 100 ug
Gene Name CALML6
Gene Alias CAGLP
Gene Description calmodulin-like 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CALML6 (AAI60060.1, 1 a.a. ~ 181 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 163688

Enviar un mensaje


CALML6 purified MaxPab rabbit polyclonal antibody (D01P)

CALML6 purified MaxPab rabbit polyclonal antibody (D01P)